LOCUS HIVFLD1 360 bp ss-RNA VRL 09-JUL-1992 DEFINITION Human immunodeficiency virus type 1, viral sample FLD1, V3 region. ACCESSION M90848 KEYWORDS . SOURCE Human immunodeficiency virus type 1 (HIV-1), M13 clone 1 of DNA ID 4430. ORGANISM Human immunodeficiency virus type 1 Viridae; ss-RNA enveloped viruses; Positive strand RNA virus; Retroviridae; Lentivirinae. REFERENCE 1 (bases 1 to 360) AUTHORS Ou,C.-Y.-., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C., Korber,B.T., Mullins,J.I., Schochetman,G., Berkelman,R.L., Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., Curran,J.W. and Jaffe,H.W. TITLE Molecular Epidemiology of HIV Transmission in a Dental Practice JOURNAL Science 256, 1165-1171 (1992) STANDARD full automatic COMMENT Kindly submitted in computer readable form by the CDC (Centers for Disease Control), Atlanta, GA. The sequence in this entry is one of 6 clone sequences over the V3 region obtained by the CDC from a Florida dentist. Please note that for this set of sequences, clone numbers from the V3 region do not correspond with similar numbers from the V4C3V5 region. NCBI gi: 326847 FEATURES Location/Qualifiers CDS <1..>360 /note="env polyprotein; NCBI gi: 326848." /codon_start=1 /translation="LAEEEVVIRSANFTDNAKIIIVQLNASVEINCTRPNNNTRKGIH IGPGRAFYATGEIIGDIRQAHCNISREKWNNTLNQVVTELREQFGNKTITFNHSSGGD PEIVMHSFNCGGEFFYCN" source 1..360 /organism="Human immunodeficiency virus type 1" BASE COUNT 148 a 50 c 73 g 89 t ORIGIN near the C2-V3 boundary 1 ctagcagaag aagaggtagt aattagatct gccaatttca cagacaatgc taaaatcata 61 atagtacagc tgaatgcatc tgtagaaatt aattgtacaa ggcccaacaa caatacaaga 121 aaaggtatac atataggacc agggagagca ttttatgcaa caggagaaat aataggagat 181 ataagacaag cacattgtaa cattagtaga gaaaaatgga ataatacttt aaaccaggta 241 gttacagaat taagggaaca atttgggaat aaaacaataa cctttaatca ctcctcagga 301 ggggacccag aaattgtaat gcacagtttt aattgtggag gggaattttt ctattgtaat LOCUS HIVFLPBD3 343 bp ss-RNA VRL 09-JUL-1992 DEFINITION Human immunodeficiency virus type 1, viral sample FLPBD3, V3 region. ACCESSION M90873 KEYWORDS . SOURCE Human immunodeficiency virus type 1 (HIV-1), M13 clone DA3 of DNA ID 5592. ORGANISM Human immunodeficiency virus type 1 Viridae; ss-RNA enveloped viruses; Positive strand RNA virus; Retroviridae; Lentivirinae. REFERENCE 1 (bases 1 to 343) AUTHORS Ou,C.-Y.-., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C., Korber,B.T., Mullins,J.I., Schochetman,G., Berkelman,R.L., Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., Curran,J.W. and Jaffe,H.W. TITLE Molecular Epidemiology of HIV Transmission in a Dental Practice JOURNAL Science 256, 1165-1171 (1992) STANDARD full automatic COMMENT Kindly submitted in computer readable form by the CDC (Centers for Disease Control), Atlanta, GA. The sequence in this entry is one of 13 clone sequences over the V3 region obtained by the CDC from patient 'B' of a Florida dentist. Please note that for this set of sequences, clone numbers from the V3 region do not correspond with similar numbers from the V4C3V5 region. NCBI gi: 326972 FEATURES Location/Qualifiers CDS <1..>343 /note="env polyprotein; NCBI gi: 326973." /codon_start=1 /translation="LAEEEIVIRSANFTDNAKIIIVQLNASVEINCTRPDNNTRKGIH IGPGRAFYATGEIIGDIRQAHCNISGAKWNNTIEQVKTKLREQFGNKTIIFNHSSGGD PEIVMHSFNCGGX" source 1..343 /organism="Human immunodeficiency virus type 1" BASE COUNT 146 a 48 c 72 g 77 t ORIGIN near the C2-V3 boundary 1 ctagcagaag aagagatagt aattagatct gccaatttca cagacaatgc taaaatcata 61 atagtacagc tgaatgcatc tgtagaaatt aattgtacaa gacccgacaa caatacaaga 121 aaaggtatac atataggacc agggagggca ttttatgcaa caggagaaat aataggagat 181 ataagacaag cacattgtaa cattagtgga gcaaaatgga ataatactat agaacaggta 241 aagacaaaat taagagaaca atttgggaat aaaacaataa tctttaatca ctcctcagga 301 ggggacccag aaattgtaat gcacagtttt aattgtggag ggg // LOCUS HIVFLPC14 349 bp ss-RNA VRL 09-JUL-1992 DEFINITION Human immunodeficiency virus type 1, viral sample FLPC14, V3 region. ACCESSION M90878 KEYWORDS . SOURCE Human immunodeficiency virus type 1 (HIV-1), M13 clone A14 of DNA ID 5606. ORGANISM Human immunodeficiency virus type 1 Viridae; ss-RNA enveloped viruses; Positive strand RNA virus; Retroviridae; Lentivirinae. REFERENCE 1 (bases 1 to 349) AUTHORS Ou,C.-Y.-., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C., Korber,B.T., Mullins,J.I., Schochetman,G., Berkelman,R.L., Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., Curran,J.W. and Jaffe,H.W. TITLE Molecular Epidemiology of HIV Transmission in a Dental Practice JOURNAL Science 256, 1165-1171 (1992) STANDARD full automatic COMMENT Kindly submitted in computer readable form by the CDC (Centers for Disease Control), Atlanta, GA. The sequence in this entry is one of 5 clones over the V3 region obtained by the CDC from patient 'C' of a Florida dentist. Please note that for this set of sequences, clone numbers from the V3 region do not correspond with similar numbers from the V4C3V5 region. NCBI gi: 327000 FEATURES Location/Qualifiers CDS <1..>349 /note="env polyprotein; NCBI gi: 327001." /codon_start=1 /translation="LAEEEVVIRSADFTDNAKIIIVQLNASVEINCTRPNNNTRKGIH IGPGRAVYATDRIIGDIRQAHCNISREKWNNTLKQVVTKLREQFVNKTIIFTHPSGGD PEIVMHSVNCGGEFX" source 1..349 /organism="Human immunodeficiency virus type 1" BASE COUNT 148 a 49 c 69 g 83 t ORIGIN near the C2-V3 boundary 1 ctagcagaag aagaggtagt aattagatct gccgatttca cagacaatgc taaaatcata 61 atagtacagc taaatgcatc tgtagaaatt aattgtacaa gacctaacaa caatacaaga 121 aaaggtatac atataggacc agggagagca gtttatgcaa cagacagaat aataggagat 181 ataagacaag cacattgtaa cattagtaga gaaaaatgga ataatacttt aaaacaggta 241 gttacaaaat taagagaaca atttgtgaat aaaacaataa tctttactca cccctcagga 301 ggggacccag aaattgtaat gcacagtgtt aattgtggag gggaatttt // LOCUS HIVFLPD9 337 bp ss-RNA VRL 09-JUL-1992 DEFINITION Human immunodeficiency virus type 1, viral sample FLPD9, V3 region. ACCESSION M90885 KEYWORDS . SOURCE Human immunodeficiency virus type 1 (HIV-1), M13 clone A09 of DNA ID 5826. ORGANISM Human immunodeficiency virus type 1 Viridae; ss-RNA enveloped viruses; Positive strand RNA virus; Retroviridae; Lentivirinae. REFERENCE 1 (bases 1 to 337) AUTHORS Ou,C.-Y.-., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C., Korber,B.T., Mullins,J.I., Schochetman,G., Berkelman,R.L., Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., Curran,J.W. and Jaffe,H.W. TITLE Molecular Epidemiology of HIV Transmission in a Dental Practice JOURNAL Science 256, 1165-1171 (1992) STANDARD full automatic COMMENT Kindly submitted in computer readable form by the CDC (Centers for Disease Control), Atlanta, GA. The sequence in this entry is one of 5 clones over the V3 region obtained by the CDC from patient 'D' of a Florida dentist. Please note that for this set of sequences, clone numbers from the V3 region do not correspond with similar numbers from the V4C3V5 region. NCBI gi: 327038 FEATURES Location/Qualifiers CDS <1..>337 /note="env polyprotein; NCBI gi: 327039." /codon_start=1 /translation="LAEEEVVIRSANFSDNAKTIIVQLNKSVKIPCIRPSNNTRQSIP IGPGKAVYATGQIIGDIRKAHRNLSEAIWNNTLKQIVKKLKEQFKNKTIVFNQSSGGD PEIVMHSFNCX" source 1..337 /organism="Human immunodeficiency virus type 1" BASE COUNT 146 a 51 c 62 g 78 t ORIGIN near the C2-V3 boundary 1 ctagcagaag aagaggtagt aattagatct gcaaatttct cggacaatgc taaaaccata 61 atagtacagc tgaataaatc tgtaaaaatt ccttgtataa gacccagcaa taatacaaga 121 caaagtatac ctataggacc agggaaagca gtttatgcaa caggacagat aataggagat 181 ataagaaagg cacatcgtaa ccttagtgaa gcaatatgga ataacacgtt aaaacagata 241 gttaaaaaat taaaagaaca atttaagaat aaaacaatag tcttcaatca atcctcagga 301 ggggacccag aaattgtaat gcacagtttt aattgtg // LOCUS HIVFLQ511 325 bp ss-RNA VRL 09-JUL-1992 DEFINITION Human immunodeficiency virus type 1, viral sample LC01.DA11, V3 region. ACCESSION M90915 KEYWORDS . SOURCE Human immunodeficiency virus type 1 (HIV-1), M13 clone DA11 of DNA ID 5240. ORGANISM Human immunodeficiency virus type 1 Viridae; ss-RNA enveloped viruses; Positive strand RNA virus; Retroviridae; Lentivirinae. REFERENCE 1 (bases 1 to 325) AUTHORS Ou,C.-Y.-., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C., Korber,B.T., Mullins,J.I., Schochetman,G., Berkelman,R.L., Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., Curran,J.W. and Jaffe,H.W. TITLE Molecular Epidemiology of HIV Transmission in a Dental Practice JOURNAL Science 256, 1165-1171 (1992) STANDARD full automatic COMMENT Kindly submitted in computer readable form by the CDC (Centers for Disease Control), Atlanta, GA. The sequence in this entry is one of 2 clones over the V3 region obtained by the CDC from this Florida control sample. Please note that for this set of sequences, clone numbers from the V3 region do not correspond with similar numbers from the V4C3V5 region. NCBI gi: 327201 FEATURES Location/Qualifiers CDS <1..>325 /note="env polyprotein; NCBI gi: 327202." /codon_start=1 /translation="LAEEEVVIRSENFTNNAKIIIVHLNKTVNITCTRPNNNTRRSIP MGPGKAFYTTEIIGNIRQAHCNLSKAEWNNTLRQIVKKLREQFKNKTIVFNHSSGGDP EIVMHSX" source 1..325 /organism="Human immunodeficiency virus type 1" BASE COUNT 148 a 49 c 54 g 74 t ORIGIN near the C2-V3 boundary 1 ctagcagaag aagaagtagt aattagatct gaaaatttca cgaataatgc taaaatcata 61 atagtacacc tgaataaaac tgtaaatatt acttgtacaa gacccaacaa caatacaaga 121 agaagtatac ctatgggacc agggaaagca ttttatacaa cagaaataat aggaaatata 181 agacaagcac attgtaacct tagtaaagca gaatggaata acactttaag acagatagtt 241 aaaaagttaa gagaacaatt taagaataaa acaatagtct tcaatcactc ctcaggaggg 301 gacccagaaa ttgtaatgca cagtt // LOCUS HIVFLQ11 330 bp ss-RNA VRL 09-JUL-1992 DEFINITION Human immunodeficiency virus type 1, viral sample LC05.EA14N, V3 region. ACCESSION M90934 KEYWORDS . SOURCE Human immunodeficiency virus type 1 (HIV-1), direct PCR amplification product of Florida control sample EA14N of DNA ID 5292. ORGANISM Human immunodeficiency virus type 1 Viridae; ss-RNA enveloped viruses; Positive strand RNA virus; Retroviridae; Lentivirinae. REFERENCE 1 (bases 1 to 330) AUTHORS Ou,C.-Y.-., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C., Korber,B.T., Mullins,J.I., Schochetman,G., Berkelman,R.L., Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., Curran,J.W. and Jaffe,H.W. TITLE Molecular Epidemiology of HIV Transmission in a Dental Practice JOURNAL Science 256, 1165-1171 (1992) STANDARD full automatic COMMENT Kindly submitted in computer readable form by the CDC (Centers for Disease Control), Atlanta, GA. Please note that for this set of sequences, clone numbers from the V3 region do not correspond with similar numbers from the V4C3V5 region. NCBI gi: 327131 FEATURES Location/Qualifiers CDS <1..>330 /note="env polyprotein; NCBI gi: 327132." /codon_start=1 /translation="LAEEEVVIRSENFTNNAKTIIVQLKESVKINCIRPNNNTRRSIN MGPGRAFYTTGDIIGDIRQAHCNISKAEWNNTLKQIVQKLKEQFRNKTIVFNQSSGGD PEVVTHSF" source 1..330 /organism="Human immunodeficiency virus type 1" BASE COUNT 149 a 46 c 61 g 74 t ORIGIN near the C2-V3 boundary 1 ctagcagaag aggaggtagt aattagatct gaaaatttca cgaacaatgc taaaaccata 61 atagtacaac tgaaagaatc tgtaaaaatt aattgtataa gacccaacaa caatacaaga 121 agaagtataa atatgggacc agggagggca ttttatacaa caggagacat aataggagat 181 ataagacaag cacattgtaa cattagtaaa gcagagtgga ataacacttt aaaacagata 241 gttcaaaaat taaaagaaca atttaggaat aaaacaatag tctttaatca atcctcagga 301 ggggacccag aagttgtaac acacagtttt //